PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.046570.1
Common NameCsa_6G518210, LOC101220018
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ARF
Protein Properties Length: 733aa    MW: 80078.9 Da    PI: 7.4386
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.046570.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.56.3e-24150251199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d+ g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + ++
  Cucsa.046570.1 150 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyN-QQRPSQELVAKDLLGLKWKFRHIYRGQPRRHLLTTGWSAFVNKKRLVSGDAVLFL--RGND 241
                     99****************************963.3445679************************************************..4489 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+++++r+
  Cucsa.046570.1 242 GELRLGIRRA 251
                     999****996 PP

2Auxin_resp105.75.5e-35276357182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     +++a+s+ks F+v+YnPra++s+Fv +++k++k++++++svG Rf+++fet+d + rr +G ++gvsd+dp+rWp+S+WrsL
  Cucsa.046570.1 276 VVNAVSSKSSFSVCYNPRAASSQFVLPFHKFLKSINHSFSVGLRFRLSFETDDGADRRHTGHITGVSDVDPIRWPGSRWRSL 357
                     6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.4E-39144255IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.8E-41145259IPR015300DNA-binding pseudobarrel domain
CDDcd100177.91E-22148250No hitNo description
PfamPF023627.4E-22150251IPR003340B3 DNA binding domain
PROSITE profilePS5086313.225150252IPR003340B3 DNA binding domain
SMARTSM010193.3E-21150252IPR003340B3 DNA binding domain
PfamPF065072.9E-30277357IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MGALIDLNTT EEDESHSPAG SSVSSSSASA LTSSPSPSVT SSICLELWHA CAGPLTSLPK  60
KGSLVVYLPQ GHFEQMQEFP PTPYDLPPHI LCRVIDVQLH AEAGSDEVYA QVSLFPENEQ  120
MEHKMQEEMN NDSEEEDVEE GEKTTTPHMF CKTLTASDTS THGGFSVPRR AAEDCFPPLD  180
YNQQRPSQEL VAKDLLGLKW KFRHIYRGQP RRHLLTTGWS AFVNKKRLVS GDAVLFLRGN  240
DGELRLGIRR AAQLKSGSAF SNICSQQLNS SSIMDVVNAV SSKSSFSVCY NPRAASSQFV  300
LPFHKFLKSI NHSFSVGLRF RLSFETDDGA DRRHTGHITG VSDVDPIRWP GSRWRSLMVR  360
WDDGETNRHG RVSPWEIEPS GSVSLSTNLV PPGLKRTRIG LSSTKLEFPV PNGIGASDFG  420
ESLRFQKVLQ GQEILGYSTP PDGDNNNRCP PEKRRLIPGL HGSGIALMRN GPRNPLINSE  480
TSSRGIVFDE SFQYHKVLQG QEIFPSPYYG RAVATNEVKA NGGCSPADGI RLPRTKDGWP  540
MAMQCENFLT RSSIPSVQVS SPSSVFMFQQ SMVPVQSFNS HNRGNFAEQR IMNKSTSHHS  600
GTTFMTDHSM NTEFIPQGMC PTSLGEQNQL GLSHPSTTTA SAAFTVSKDL SSTCKAGCRL  660
FGFSLTEEKN VGNKDDKGSS ATTPINAGTT TVLSNMGVQC PLKSPLMNKV VGSNCTKVSN  720
LSARAVEAIY FA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_B1e-1113538611361Auxin response factor 1
4ldy_A1e-1113538611361Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU3234100.0KU323410.1 UNVERIFIED: Trichosanthes dioica clone TdARF_8 auxin response factor 3-like mRNA, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004134681.10.0PREDICTED: auxin response factor 3 isoform X2
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLA0A0A0KNG30.0A0A0A0KNG3_CUCSA; Auxin response factor
STRINGGLYMA13G30750.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45763355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]